PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe5G377400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 267aa    MW: 30394.1 Da    PI: 6.0393
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe5G377400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.34.3e-141461148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       rg+WT eEd +l   +   G ++W+ I+++ g+ R++k+c++rw +yl
  Aqcoe5G377400.1.p 14 RGPWTIEEDHKLMSFIINNGIHCWRMIPKHAGLLRCGKSCRLRWINYL 61
                       89******************************99************97 PP

2Myb_DNA-binding49.51e-1567110146
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        rg  ++ E+ ++++++++lG++ W++Ia++++ gRt++++k++w++
  Aqcoe5G377400.1.p  67 RGTLSEFEENQIIQLHARLGNR-WSKIAAHFP-GRTDNEIKNHWNT 110
                        5666788***************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.5E-21564IPR009057Homeodomain-like
PROSITE profilePS5129414.86961IPR017930Myb domain
SuperFamilySSF466892.13E-2711108IPR009057Homeodomain-like
SMARTSM007171.6E-71363IPR001005SANT/Myb domain
PfamPF002496.8E-121461IPR001005SANT/Myb domain
CDDcd001672.90E-61661No hitNo description
PROSITE profilePS5129425.17762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.1E-2465116IPR009057Homeodomain-like
SMARTSM007177.3E-1466114IPR001005SANT/Myb domain
PfamPF002492.0E-1467110IPR001005SANT/Myb domain
CDDcd001671.37E-1074110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MGRQPCCEKI GLKRGPWTIE EDHKLMSFII NNGIHCWRMI PKHAGLLRCG KSCRLRWINY  60
LRPDLKRGTL SEFEENQIIQ LHARLGNRWS KIAAHFPGRT DNEIKNHWNT RIKKRLKLLG  120
LDPLTHMPLQ QSVQDATESE QTSHSNEDKE PQIKPLSNPA LESYAVGEKM QEKFEVGSDD  180
TINLFNSYEM LWDSFNLESA VQSSETTTSN SSSTSTSLSI TDSFNPSMGE SSSLQEDSHC  240
IPSVDSLLSW DGFNPFDDFF PLQNYL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-28121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00510DAPTransfer from AT5G14340Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010250867.11e-113PREDICTED: myb-related protein 315-like
RefseqXP_010250868.11e-113PREDICTED: myb-related protein 315-like
SwissprotP813943e-75MYB15_ANTMA; Myb-related protein 315
TrEMBLA0A0B2PT781e-108A0A0B2PT78_GLYSO; Myb-related protein 315
TrEMBLI1MLP51e-108I1MLP5_SOYBN; Uncharacterized protein
STRINGGLYMA16G06900.11e-108(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14340.14e-79myb domain protein 40